Lineage for d1es6a2 (1es6 A:201-321)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 295495Fold b.31: EV matrix protein [50011] (1 superfamily)
    consists of two beta-sandwich domains of similar topologies
  4. 295496Superfamily b.31.1: EV matrix protein [50012] (1 family) (S)
  5. 295497Family b.31.1.1: EV matrix protein [50013] (1 protein)
  6. 295498Protein EV matrix protein [50014] (1 species)
  7. 295499Species Ebola virus [TaxId:205488] [50015] (3 PDB entries)
  8. 295502Domain d1es6a2: 1es6 A:201-321 [83049]
    mutant

Details for d1es6a2

PDB Entry: 1es6 (more details), 2 Å

PDB Description: crystal structure of the matrix protein of ebola virus

SCOP Domain Sequences for d1es6a2:

Sequence, based on SEQRES records: (download)

>d1es6a2 b.31.1.1 (A:201-321) EV matrix protein {Ebola virus}
galrpgisfhpklrpillpnksgkkgnsadltspekiqaimtslqdfkivpidptknimg
ievpetlvlkltgkkvtskngqpiipvllpkyigldpvapgdltmvitqdcdtchspasl
p

Sequence, based on observed residues (ATOM records): (download)

>d1es6a2 b.31.1.1 (A:201-321) EV matrix protein {Ebola virus}
galrpgisfhpklrpillpnknsadltspekiqaimtslqdfkivpidptknimgievpe
tlvlkltggqpiipvllpkyigldpvapgdltmvitqdcdtchspaslp

SCOP Domain Coordinates for d1es6a2:

Click to download the PDB-style file with coordinates for d1es6a2.
(The format of our PDB-style files is described here.)

Timeline for d1es6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1es6a1