Lineage for d1bmv22 (1bmv 2:2001-2189)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 304390Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 304471Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (7 families) (S)
  5. 304722Family b.121.4.2: Comoviridae-like VP [88636] (2 proteins)
    duplication: mature coat protein consists of three similar domains that can be in a single chain or in two separate chains
  6. 304723Protein Comovirus coat proteins (VP37 and VP23) [49627] (2 species)
  7. 304724Species BPMV (Bean pod mottle virus) [TaxId:12260] [49628] (1 PDB entry)
  8. 304727Domain d1bmv22: 1bmv 2:2001-2189 [83043]

Details for d1bmv22

PDB Entry: 1bmv (more details), 3 Å

PDB Description: protein-rna interactions in an icosahedral virus at 3.0 angstroms resolution

SCOP Domain Sequences for d1bmv22:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmv22 b.121.4.2 (2:2001-2189) Comovirus coat proteins (VP37 and VP23) {BPMV (Bean pod mottle virus)}
cvlnpqnpfvlnrwmgkltfpqgtsrsvkrmplsigggagaksailmnmpnavlsmwryf
vgdlvfevskmtspyikctvsffiafgnladdtinfeafphklvqfgeiqekvvlkfsqe
efltawstqvrpattlladgcpylyamvhdssvstipgdfvigvkltiienmcayglnpg
isgsrllgt

SCOP Domain Coordinates for d1bmv22:

Click to download the PDB-style file with coordinates for d1bmv22.
(The format of our PDB-style files is described here.)

Timeline for d1bmv22:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bmv21
View in 3D
Domains from other chains:
(mouse over for more information)
d1bmv11