Lineage for d1o9la1 (1o9l A:40-286)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 404937Fold c.124: NagB/RpiA/CoA transferase [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 404938Superfamily c.124.1: NagB/RpiA/CoA transferase [100950] (4 families) (S)
  5. 404968Family c.124.1.2: CoA transferase alpha subunit-like [74656] (3 proteins)
    parallel beta-sheet of 7 strands, order 4321567
  6. 404977Protein Succinate:CoA transferase, N-terminal domain [82464] (1 species)
  7. 404978Species Pig (Sus scrofa) [TaxId:9823] [82465] (5 PDB entries)
  8. 404985Domain d1o9la1: 1o9l A:40-286 [81241]
    Other proteins in same PDB: d1o9la2, d1o9lb2, d1o9lc2, d1o9ld2

Details for d1o9la1

PDB Entry: 1o9l (more details), 2.4 Å

PDB Description: succinate:coenzyme-a transferase (pig heart)

SCOP Domain Sequences for d1o9la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o9la1 c.124.1.2 (A:40-286) Succinate:CoA transferase, N-terminal domain {Pig (Sus scrofa)}
tkfytdaveavkdipngatvlvggfglcgipenligallktgvkeltavsnnagvdnfgl
glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
erlsvrk

SCOP Domain Coordinates for d1o9la1:

Click to download the PDB-style file with coordinates for d1o9la1.
(The format of our PDB-style files is described here.)

Timeline for d1o9la1: