Lineage for d1o94b3 (1o94 B:341-489,B:646-729)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850289Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2850290Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
    this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains
  5. 2850291Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins)
  6. 2850348Protein Trimethylamine dehydrogenase, middle domain [51973] (1 species)
  7. 2850349Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51974] (5 PDB entries)
  8. 2850351Domain d1o94b3: 1o94 B:341-489,B:646-729 [81205]
    Other proteins in same PDB: d1o94a1, d1o94a2, d1o94b1, d1o94b2, d1o94c_, d1o94d_, d1o94e_, d1o94f_
    complexed with adp, amp, fmn, sf4

Details for d1o94b3

PDB Entry: 1o94 (more details), 2 Å

PDB Description: Ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein
PDB Compounds: (B:) trimethylamine dehydrogenase

SCOPe Domain Sequences for d1o94b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o94b3 c.4.1.1 (B:341-489,B:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
dirvcigcnvcisrweiggppmictqnatageeyrrgwhpekfrqtknkdsvlivgagps
gseaarvlmesgytvhltdtaekigghlnqvaalpglgewsyhrdyretqitkllkknke
sqlalgqkpmtaddvlqygadkviiatgaXsectlwnelkaresewaendikgiyligda
eaprliadatftghrvareieeanpqiaipykretiawgtphmpggnfkieykv

SCOPe Domain Coordinates for d1o94b3:

Click to download the PDB-style file with coordinates for d1o94b3.
(The format of our PDB-style files is described here.)

Timeline for d1o94b3: