SCOPe 2.08: Domain d1o8bb2: 1o8b B:127-198

Lineage for d1o8bb2 (1o8b B:127-198)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.40: D-ribose-5-phosphate isomerase (RpiA), lid domain [75445] (1 family)

5. Family d.58.40.1: D-ribose-5-phosphate isomerase (RpiA), lid domain [75446] (1 protein)

6. Protein D-ribose-5-phosphate isomerase (RpiA), lid domain [75447] (4 species)

7. Species Escherichia coli [TaxId:562] [75448] (3 PDB entries)

8. Domain d1o8bb2: 1o8b B:127-198 [81183]
   Other proteins in same PDB: d1o8ba1, d1o8bb1
   complexed with abf

Details for d1o8bb2

PDB Entry: 1o8b, 1.25 Å

PDB Description: structure of escherichia coli ribose-5-phosphate isomerase, rpia, complexed with arabinose-5-phosphate.

PDB Compounds: (B:) Ribose 5-phosphate isomerase

SCOPe Domain Sequences for d1o8bb2:

Sequence; same for both SEQRES and ATOM records:

>d1o8bb2 d.58.40.1 (B:127-198) D-ribose-5-phosphate isomerase (RpiA), lid domain {Escherichia coli [TaxId: 562]}
gkfplpvevipmarsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpiamenai
naipgvvtvglf

Timeline for d1o8bb2:

• d1o8bb2 first appeared in SCOP 1.63
  
• d1o8bb2 appears in SCOPe 2.07