Lineage for d1o7wb_ (1o7w B:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 408884Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 409086Superfamily d.17.4: NTF2-like [54427] (10 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 409206Family d.17.4.4: Naphthalene 1,2-dioxygenase beta subunit [54438] (1 protein)
  6. 409207Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (1 species)
  7. 409208Species Pseudomonas putida [TaxId:303] [54440] (8 PDB entries)
  8. 409213Domain d1o7wb_: 1o7w B: [81170]
    Other proteins in same PDB: d1o7wa1, d1o7wa2
    complexed with edo, fe, fes, so4

Details for d1o7wb_

PDB Entry: 1o7w (more details), 1.9 Å

PDB Description: naphthalene 1,2-dioxygenase, fully reduced form

SCOP Domain Sequences for d1o7wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o7wb_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas putida}
miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse
vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit
nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp
erilqthnlmvfl

SCOP Domain Coordinates for d1o7wb_:

Click to download the PDB-style file with coordinates for d1o7wb_.
(The format of our PDB-style files is described here.)

Timeline for d1o7wb_: