Lineage for d1o7wa2 (1o7w A:155-447)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 610723Fold d.129: TBP-like [55944] (9 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 610890Superfamily d.129.3: Bet v1-like [55961] (6 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 610933Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (2 proteins)
    Pfam 00848; contains a few insertion and C-terminal extension compared with Bet v1
  6. 610942Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (1 species)
  7. 610943Species Pseudomonas putida [TaxId:303] [55971] (8 PDB entries)
  8. 610948Domain d1o7wa2: 1o7w A:155-447 [81169]
    Other proteins in same PDB: d1o7wa1, d1o7wb_
    complexed with edo, fe, fes, so4

Details for d1o7wa2

PDB Entry: 1o7w (more details), 1.9 Å

PDB Description: naphthalene 1,2-dioxygenase, fully reduced form

SCOP Domain Sequences for d1o7wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o7wa2 d.129.3.3 (A:155-447) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Pseudomonas putida}
eapplmdylgdaawylepmfkhsgglelvgppgkvvikanwkapaenfvgdayhvgwtha
sslrsgesifsslagnaalppegaglqmtskygsgmgvlwdgysgvhsadlvpelmafgg
akqerlnkeigdvrariyrshlnctvfpnnsmltcsgvfkvwnpidanttevwtyaivek
dmpedlkrrladsvqrtfgpagfwesddndnmetasqngkkyqsrdsdllsnlgfgedvy
gdavypgvvgksaigetsyrgfyrayqahvsssnwaefehasstwhteltktt

SCOP Domain Coordinates for d1o7wa2:

Click to download the PDB-style file with coordinates for d1o7wa2.
(The format of our PDB-style files is described here.)

Timeline for d1o7wa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o7wa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1o7wb_