Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (7 proteins) Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1 |
Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (5 species) |
Species Pseudomonas putida [TaxId:303] [55971] (10 PDB entries) |
Domain d1o7wa2: 1o7w A:155-447 [81169] Other proteins in same PDB: d1o7wa1, d1o7wb_ complexed with edo, fe, fes, so4 |
PDB Entry: 1o7w (more details), 1.9 Å
SCOPe Domain Sequences for d1o7wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o7wa2 d.129.3.3 (A:155-447) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Pseudomonas putida [TaxId: 303]} eapplmdylgdaawylepmfkhsgglelvgppgkvvikanwkapaenfvgdayhvgwtha sslrsgesifsslagnaalppegaglqmtskygsgmgvlwdgysgvhsadlvpelmafgg akqerlnkeigdvrariyrshlnctvfpnnsmltcsgvfkvwnpidanttevwtyaivek dmpedlkrrladsvqrtfgpagfwesddndnmetasqngkkyqsrdsdllsnlgfgedvy gdavypgvvgksaigetsyrgfyrayqahvsssnwaefehasstwhteltktt
Timeline for d1o7wa2: