Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (12 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.4: Ring hydroxylating beta subunit (Pfam 00866) [54438] (2 proteins) |
Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (1 species) |
Species Pseudomonas putida [TaxId:303] [54440] (8 PDB entries) |
Domain d1o7mb_: 1o7m B: [81161] Other proteins in same PDB: d1o7ma1, d1o7ma2 |
PDB Entry: 1o7m (more details), 1.75 Å
SCOP Domain Sequences for d1o7mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o7mb_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas putida} miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp erilqthnlmvfl
Timeline for d1o7mb_: