Lineage for d1o7mb_ (1o7m B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 500605Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 500831Superfamily d.17.4: NTF2-like [54427] (12 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 500956Family d.17.4.4: Ring hydroxylating beta subunit (Pfam 00866) [54438] (2 proteins)
  6. 500965Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (1 species)
  7. 500966Species Pseudomonas putida [TaxId:303] [54440] (8 PDB entries)
  8. 500970Domain d1o7mb_: 1o7m B: [81161]
    Other proteins in same PDB: d1o7ma1, d1o7ma2

Details for d1o7mb_

PDB Entry: 1o7m (more details), 1.75 Å

PDB Description: naphthalene 1,2-dioxygenase, binary complex with dioxygen

SCOP Domain Sequences for d1o7mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o7mb_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas putida}
miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse
vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit
nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp
erilqthnlmvfl

SCOP Domain Coordinates for d1o7mb_:

Click to download the PDB-style file with coordinates for d1o7mb_.
(The format of our PDB-style files is described here.)

Timeline for d1o7mb_: