Lineage for d1o7ma2 (1o7m A:155-448)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040331Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1040549Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1040621Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (6 proteins)
    Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1
  6. 1040636Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (2 species)
  7. 1040637Species Pseudomonas putida [TaxId:303] [55971] (16 PDB entries)
  8. 1040648Domain d1o7ma2: 1o7m A:155-448 [81160]
    Other proteins in same PDB: d1o7ma1, d1o7mb_
    complexed with edo, fe, fes, oxy, so4

Details for d1o7ma2

PDB Entry: 1o7m (more details), 1.75 Å

PDB Description: naphthalene 1,2-dioxygenase, binary complex with dioxygen
PDB Compounds: (A:) Naphthalene 1,2-dioxygenase alpha subunit

SCOPe Domain Sequences for d1o7ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o7ma2 d.129.3.3 (A:155-448) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Pseudomonas putida [TaxId: 303]}
eapplmdylgdaawylepmfkhsgglelvgppgkvvikanwkapaenfvgdayhvgwtha
sslrsgesifsslagnaalppegaglqmtskygsgmgvlwdgysgvhsadlvpelmafgg
akqerlnkeigdvrariyrshlnctvfpnnsmltcsgvfkvwnpidanttevwtyaivek
dmpedlkrrladsvqrtfgpagfwesddndnmetasqngkkyqsrdsdllsnlgfgedvy
gdavypgvvgksaigetsyrgfyrayqahvsssnwaefehasstwhteltkttd

SCOPe Domain Coordinates for d1o7ma2:

Click to download the PDB-style file with coordinates for d1o7ma2.
(The format of our PDB-style files is described here.)

Timeline for d1o7ma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o7ma1
View in 3D
Domains from other chains:
(mouse over for more information)
d1o7mb_