Lineage for d1o7hb_ (1o7h B:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 254865Fold d.17: Cystatin-like [54402] (5 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 255033Superfamily d.17.4: NTF2-like [54427] (6 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 255130Family d.17.4.4: Naphthalene 1,2-dioxygenase beta subunit [54438] (1 protein)
  6. 255131Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (1 species)
  7. 255132Species Pseudomonas putida [TaxId:303] [54440] (8 PDB entries)
  8. 255139Domain d1o7hb_: 1o7h B: [81139]
    Other proteins in same PDB: d1o7ha1, d1o7ha2
    complexed with edo, fe, fes, so4

Details for d1o7hb_

PDB Entry: 1o7h (more details), 2.2 Å

PDB Description: naphthalene 1,2-dioxygenase with oxidized rieske iron sulphur center site.

SCOP Domain Sequences for d1o7hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o7hb_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas putida}
miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse
vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit
nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp
erilqthnlmvfl

SCOP Domain Coordinates for d1o7hb_:

Click to download the PDB-style file with coordinates for d1o7hb_.
(The format of our PDB-style files is described here.)

Timeline for d1o7hb_: