![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (2 families) ![]() |
![]() | Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (2 proteins) |
![]() | Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (1 species) |
![]() | Species Pseudomonas putida [TaxId:303] [50035] (8 PDB entries) |
![]() | Domain d1o7ha1: 1o7h A:1-154 [81137] Other proteins in same PDB: d1o7ha2, d1o7hb_ complexed with edo, fe, fes, so4 |
PDB Entry: 1o7h (more details), 2.2 Å
SCOP Domain Sequences for d1o7ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o7ha1 b.33.1.2 (A:1-154) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Pseudomonas putida} mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe kdlygeslnkkclglkevarvesfhgfiygcfdq
Timeline for d1o7ha1: