Lineage for d1o7ha1 (1o7h A:1-154)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 557197Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 557198Superfamily b.33.1: ISP domain [50022] (2 families) (S)
  5. 557259Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (2 proteins)
  6. 557268Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (1 species)
  7. 557269Species Pseudomonas putida [TaxId:303] [50035] (8 PDB entries)
  8. 557276Domain d1o7ha1: 1o7h A:1-154 [81137]
    Other proteins in same PDB: d1o7ha2, d1o7hb_
    complexed with edo, fe, fes, so4

Details for d1o7ha1

PDB Entry: 1o7h (more details), 2.2 Å

PDB Description: naphthalene 1,2-dioxygenase with oxidized rieske iron sulphur center site.

SCOP Domain Sequences for d1o7ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o7ha1 b.33.1.2 (A:1-154) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Pseudomonas putida}
mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
kdlygeslnkkclglkevarvesfhgfiygcfdq

SCOP Domain Coordinates for d1o7ha1:

Click to download the PDB-style file with coordinates for d1o7ha1.
(The format of our PDB-style files is described here.)

Timeline for d1o7ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o7ha2
View in 3D
Domains from other chains:
(mouse over for more information)
d1o7hb_