Lineage for d1o7gb_ (1o7g B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1019632Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1020039Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1020265Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 1020277Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (3 species)
  7. 1020278Species Pseudomonas putida [TaxId:303] [54440] (10 PDB entries)
  8. 1020281Domain d1o7gb_: 1o7g B: [81136]
    Other proteins in same PDB: d1o7ga1, d1o7ga2
    complexed with edo, fe, fes, npy, so4

Details for d1o7gb_

PDB Entry: 1o7g (more details), 1.7 Å

PDB Description: naphthalene 1,2-dioxygenase with naphthalene bound in the active site.
PDB Compounds: (B:) Naphthalene 1,2-dioxygenase beta subunit

SCOPe Domain Sequences for d1o7gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o7gb_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas putida [TaxId: 303]}
miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse
vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit
nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp
erilqthnlmvfl

SCOPe Domain Coordinates for d1o7gb_:

Click to download the PDB-style file with coordinates for d1o7gb_.
(The format of our PDB-style files is described here.)

Timeline for d1o7gb_: