Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.129: TBP-like [55944] (8 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (5 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain (Pfam 00848) [55969] (2 proteins) contains a few insertion and C-terminal extension compared with Bet v1 |
Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (1 species) |
Species Pseudomonas putida [TaxId:303] [55971] (8 PDB entries) |
Domain d1o7ga2: 1o7g A:155-448 [81135] Other proteins in same PDB: d1o7ga1, d1o7gb_ |
PDB Entry: 1o7g (more details), 1.7 Å
SCOP Domain Sequences for d1o7ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o7ga2 d.129.3.3 (A:155-448) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Pseudomonas putida} eapplmdylgdaawylepmfkhsgglelvgppgkvvikanwkapaenfvgdayhvgwtha sslrsgesifsslagnaalppegaglqmtskygsgmgvlwdgysgvhsadlvpelmafgg akqerlnkeigdvrariyrshlnctvfpnnsmltcsgvfkvwnpidanttevwtyaivek dmpedlkrrladsvqrtfgpagfwesddndnmetasqngkkyqsrdsdllsnlgfgedvy gdavypgvvgksaigetsyrgfyrayqahvsssnwaefehasstwhteltkttd
Timeline for d1o7ga2: