SCOP 1.63: Domain d1o7ga1: 1o7g A:1-154

Lineage for d1o7ga1 (1o7g A:1-154)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (2 families)

5. Family b.33.1.2: Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50033] (1 protein)

6. Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (1 species)

7. Species Pseudomonas putida [TaxId:303] [50035] (8 PDB entries)

8. Domain d1o7ga1: 1o7g A:1-154 [81134]
   Other proteins in same PDB: d1o7ga2, d1o7gb_
   complexed with edo, fe, fes, npy, so4

Details for d1o7ga1

PDB Entry: 1o7g, 1.7 Å

PDB Description: naphthalene 1,2-dioxygenase with naphthalene bound in the active site.

SCOP Domain Sequences for d1o7ga1:

Sequence; same for both SEQRES and ATOM records:

>d1o7ga1 b.33.1.2 (A:1-154) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Pseudomonas putida}
mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
kdlygeslnkkclglkevarvesfhgfiygcfdq

Timeline for d1o7ga1:

• d1o7ga1 is new in SCOP 1.63
  
• d1o7ga1 appears in SCOP 1.65
  
• d1o7ga1 appears in the current release, SCOPe 2.08