SCOP 1.63: Domain d1o6va1: 1o6v A:417-496

Lineage for d1o6va1 (1o6v A:417-496)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (17 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.15: Internalin Ig-like domain [81295] (3 proteins)
   truncated fold fused to an LRR domain

6. Protein Internalin A [81973] (1 species)

7. Species Listeria monocytogenes [TaxId:1639] [81974] (3 PDB entries)

8. Domain d1o6va1: 1o6v A:417-496 [81099]
   Other proteins in same PDB: d1o6va2, d1o6vb2

Details for d1o6va1

PDB Entry: 1o6v, 1.5 Å

PDB Description: internalin (inla, listeria monocytogenes) - functional domain, uncomplexed

SCOP Domain Sequences for d1o6va1:

Sequence; same for both SEQRES and ATOM records:

>d1o6va1 b.1.18.15 (A:417-496) Internalin A {Listeria monocytogenes}
wtnapvnykanvsipntvknvtgaliapatisdggsytepditwnlpsytnevsytfsqp
vtigkgtttfsgtvtqplka

Timeline for d1o6va1:

• d1o6va1 is new in SCOP 1.63
  
• d1o6va1 appears in SCOP 1.65
  
• d1o6va1 appears in the current release, SCOPe 2.08