Lineage for d1o23a_ (1o23 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1887016Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1887017Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1887055Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 1887056Protein alpha-Lactalbumin [53975] (6 species)
    expressed only in the lactating mammary gland, strongly binds calcium ion
  7. 1887088Species Mouse (Mus musculus) [TaxId:10090] [69628] (12 PDB entries)
  8. 1887105Domain d1o23a_: 1o23 A: [81079]
    Other proteins in same PDB: d1o23b_, d1o23d_
    complexed with ca, mes, mn, pg4, udp, upg

Details for d1o23a_

PDB Entry: 1o23 (more details), 2.32 Å

PDB Description: crystal structure of lactose synthase in the presence of udp-glucose
PDB Compounds: (A:) alpha-lactalbumin

SCOPe Domain Sequences for d1o23a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o23a_ d.2.1.2 (A:) alpha-Lactalbumin {Mouse (Mus musculus) [TaxId: 10090]}
teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
ekp

SCOPe Domain Coordinates for d1o23a_:

Click to download the PDB-style file with coordinates for d1o23a_.
(The format of our PDB-style files is described here.)

Timeline for d1o23a_: