SCOP 1.69: Domain d1o23a_: 1o23 A:

Lineage for d1o23a_ (1o23 A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein alpha-Lactalbumin [53975] (6 species)
   expressed only in the lactating mammary gland, strongly binds calcium ion

7. Species Mouse (Mus musculus) [TaxId:10090] [69628] (9 PDB entries)

8. Domain d1o23a_: 1o23 A: [81079]
   Other proteins in same PDB: d1o23b_, d1o23d_

Details for d1o23a_

PDB Entry: 1o23, 2.32 Å

PDB Description: crystal structure of lactose synthase in the presence of udp-glucose

SCOP Domain Sequences for d1o23a_:

Sequence; same for both SEQRES and ATOM records:

>d1o23a_ d.2.1.2 (A:) alpha-Lactalbumin {Mouse (Mus musculus)}
teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
ekp

Timeline for d1o23a_:

• d1o23a_ first appeared in SCOP 1.63
  
• d1o23a_ appears in SCOP 1.67
  
• d1o23a_ appears in SCOP 1.71
  
• d1o23a_ appears in the current release, SCOPe 2.08