Lineage for d1o1wa_ (1o1w A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1859086Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1859087Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 1859138Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)
  7. 1859148Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (101 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 1859258Domain d1o1wa_: 1o1w A: [81078]
    RNase H domain only

Details for d1o1wa_

PDB Entry: 1o1w (more details)

PDB Description: solution structure of the rnase h domain of the hiv-1 reverse transcriptase in the presence of magnesium
PDB Compounds: (A:) Ribonuclease H

SCOPe Domain Sequences for d1o1wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o1wa_ c.55.3.1 (A:) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
mnelyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqai
ylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgi
ggneqvdklvsagirkvl

SCOPe Domain Coordinates for d1o1wa_:

Click to download the PDB-style file with coordinates for d1o1wa_.
(The format of our PDB-style files is described here.)

Timeline for d1o1wa_: