| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) ![]() consists of one domain of this fold |
| Family c.55.3.1: Ribonuclease H [53099] (5 proteins) |
| Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species) |
| Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (101 PDB entries) Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595 |
| Domain d1o1wa_: 1o1w A: [81078] RNase H domain only |
PDB Entry: 1o1w (more details)
SCOPe Domain Sequences for d1o1wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o1wa_ c.55.3.1 (A:) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
mnelyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqai
ylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgi
ggneqvdklvsagirkvl
Timeline for d1o1wa_: