Lineage for d1o1na2 (1o1n A:145-285)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 631855Protein Hemoglobin, alpha-chain [46486] (19 species)
  7. 631932Species Human (Homo sapiens) [TaxId:9606] [46487] (178 PDB entries)
  8. 632012Domain d1o1na2: 1o1n A:145-285 [81065]
    Other proteins in same PDB: d1o1nb_, d1o1nd_
    genetically crosslinked hemoglobin
    complexed with hem

Details for d1o1na2

PDB Entry: 1o1n (more details), 1.8 Å

PDB Description: deoxy hemoglobin (a-glyglygly-c:v1m,l29w; b,d:v1m)
PDB Compounds: (A:) hemoglobin alpha chain

SCOP Domain Sequences for d1o1na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o1na2 a.1.1.2 (A:145-285) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]}
vlspadktnvkaawgkvgahageygaeawermflsfpttktyfphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyr

SCOP Domain Coordinates for d1o1na2:

Click to download the PDB-style file with coordinates for d1o1na2.
(The format of our PDB-style files is described here.)

Timeline for d1o1na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o1na1