Lineage for d1o1ma1 (1o1m A:1-141)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 349260Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 349261Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 349289Family a.1.1.2: Globins [46463] (20 proteins)
    Heme-binding protein
  6. 349408Protein Hemoglobin, alpha-chain [46486] (17 species)
  7. 349462Species Human (Homo sapiens) [TaxId:9606] [46487] (114 PDB entries)
  8. 349561Domain d1o1ma1: 1o1m A:1-141 [81060]
    Other proteins in same PDB: d1o1mb_, d1o1md_

Details for d1o1ma1

PDB Entry: 1o1m (more details), 1.85 Å

PDB Description: deoxy hemoglobin (a-glyglygly-c:v1m,l29f,h58q b,d:v1m,v67w)

SCOP Domain Sequences for d1o1ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o1ma1 a.1.1.2 (A:1-141) Hemoglobin, alpha-chain {Human (Homo sapiens)}
mlspadktnvkaawgkvgahageygaeafermflsfpttktyfphfdlshgsaqvkgqgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyr

SCOP Domain Coordinates for d1o1ma1:

Click to download the PDB-style file with coordinates for d1o1ma1.
(The format of our PDB-style files is described here.)

Timeline for d1o1ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o1ma2