SCOPe 2.08: Domain d1o1ma1: 1o1m A:1-141

Lineage for d1o1ma1 (1o1m A:1-141)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (24 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46487] (291 PDB entries)
   Uniprot P69905 P01922 P01934 P01935

8. Domain d1o1ma1: 1o1m A:1-141 [81060]
   Other proteins in same PDB: d1o1mb_, d1o1md_
   genetically crosslinked hemoglobin
   complexed with hem

Details for d1o1ma1

PDB Entry: 1o1m, 1.85 Å

PDB Description: deoxy hemoglobin (a-glyglygly-c:v1m,l29f,h58q b,d:v1m,v67w)

PDB Compounds: (A:) hemoglobin alpha chain

SCOPe Domain Sequences for d1o1ma1:

Sequence; same for both SEQRES and ATOM records:

>d1o1ma1 a.1.1.2 (A:1-141) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]}
mlspadktnvkaawgkvgahageygaeafermflsfpttktyfphfdlshgsaqvkgqgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyr

Timeline for d1o1ma1:

• d1o1ma1 first appeared in SCOP 1.63
  
• d1o1ma1 appears in SCOPe 2.07