SCOPe 2.04: Domain d1o1la1: 1o1l A:1-142

Lineage for d1o1la1 (1o1l A:1-142)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (23 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46487] (224 PDB entries)
   Uniprot P69905 P01922 P01934 P01935

8. Domain d1o1la1: 1o1l A:1-142 [81056]
   Other proteins in same PDB: d1o1lb_, d1o1ld_
   genetically crosslinked hemoglobin
   complexed with hem

Details for d1o1la1

PDB Entry: 1o1l, 1.8 Å

PDB Description: deoxy hemoglobin (a-gly-c:v1m,l29w,h58q; b,d:v1m)

PDB Compounds: (A:) hemoglobin alpha chain

SCOPe Domain Sequences for d1o1la1:

Sequence; same for both SEQRES and ATOM records:

>d1o1la1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]}
mlspadktnvkaawgkvgahageygaeawermflsfpttktyfphfdlshgsaqvkgqgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyrg

Timeline for d1o1la1:

• d1o1la1 first appeared in SCOP 1.63
  
• d1o1la1 appears in SCOPe 2.03
  
• d1o1la1 appears in SCOPe 2.05
  
• d1o1la1 appears in the current release, SCOPe 2.08