Lineage for d1o1jd_ (1o1j D:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 632305Protein Hemoglobin, beta-chain [46500] (22 species)
  7. 632381Species Human (Homo sapiens) [TaxId:9606] [46501] (173 PDB entries)
  8. 632459Domain d1o1jd_: 1o1j D: [81051]
    Other proteins in same PDB: d1o1ja1, d1o1ja2
    complexed with hem; mutant

Details for d1o1jd_

PDB Entry: 1o1j (more details), 1.9 Å

PDB Description: deoxy hemoglobin (a-gly-c:v1m,l29f,h58q; b,d:v1m,l106w)
PDB Compounds: (D:) hemoglobin beta chain

SCOP Domain Sequences for d1o1jd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o1jd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrlwgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d1o1jd_:

Click to download the PDB-style file with coordinates for d1o1jd_.
(The format of our PDB-style files is described here.)

Timeline for d1o1jd_: