Lineage for d1o13a_ (1o13 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2495539Superfamily c.55.5: Nitrogenase accessory factor-like [53146] (3 families) (S)
  5. 2495540Family c.55.5.1: MTH1175-like [53147] (3 proteins)
  6. 2495547Protein Hypothetical protein TM1816 [82446] (1 species)
  7. 2495548Species Thermotoga maritima [TaxId:2336] [82447] (2 PDB entries)
    Uniprot Q9X2D6 1-115
  8. 2495549Domain d1o13a_: 1o13 A: [80762]
    structural genomics
    CASP5

Details for d1o13a_

PDB Entry: 1o13 (more details), 1.83 Å

PDB Description: crystal structure of a putative dinitrogenase iron-molybdenum cofactor (tm1816) from thermotoga maritima at 1.83 a resolution
PDB Compounds: (A:) probable NifB protein

SCOPe Domain Sequences for d1o13a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o13a_ c.55.5.1 (A:) Hypothetical protein TM1816 {Thermotoga maritima [TaxId: 2336]}
miiaipvsenrgkdspisehfgrapyfafvkvknnaiadisveenplaqdhvhgavpnfv
kekgaelvivrgigrraiaafeamgvkvikgasgtveevvnqylsgq

SCOPe Domain Coordinates for d1o13a_:

Click to download the PDB-style file with coordinates for d1o13a_.
(The format of our PDB-style files is described here.)

Timeline for d1o13a_: