Lineage for d1o12b2 (1o12 B:44-331)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 306527Superfamily c.1.9: Metallo-dependent hydrolases [51556] (13 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 306669Family c.1.9.10: N-acetylglucosamine-6-phosphate deacetylase, catalytic domain [82261] (1 protein)
  6. 306670Protein N-acetylglucosamine-6-phosphate deacetylase, catalytic domain [82262] (1 species)
  7. 306671Species Thermotoga maritima [TaxId:243274] [82263] (1 PDB entry)
    TM0814
  8. 306673Domain d1o12b2: 1o12 B:44-331 [80761]
    Other proteins in same PDB: d1o12a1, d1o12b1
    structural genomics
    CASP5
    complexed with fe, mse

Details for d1o12b2

PDB Entry: 1o12 (more details), 2.5 Å

PDB Description: crystal structure of n-acetylglucosamine-6-phosphate deacetylase (tm0814) from thermotoga maritima at 2.5 a resolution

SCOP Domain Sequences for d1o12b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o12b2 c.1.9.10 (B:44-331) N-acetylglucosamine-6-phosphate deacetylase, catalytic domain {Thermotoga maritima}
gfvdphihgvvgadtmncdfsemeeflysqgvttflattvstslekmkeilrkardyile
npstsllgvhlegpyiskekkgahsekhirppserelseidspakmltfapeiesselll
rlvkrdivlsaghsiatfeefmkfykegvkrithfpnglkplhhreigitgaglllddvk
lelicdgvhlsremvklvykvkkangivlvtdsisaaglkdgtttlgdlvvkvkdgvprl
edgtlagstlffsqavknfrkftgcsitelakvssynscvelglddrg

SCOP Domain Coordinates for d1o12b2:

Click to download the PDB-style file with coordinates for d1o12b2.
(The format of our PDB-style files is described here.)

Timeline for d1o12b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o12b1