SCOP 1.75: Domain d1o12b1: 1o12 B:1-43,B:332-364

Lineage for d1o12b1 (1o12 B:1-43,B:332-364)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.5: N-acetylglucosamine-6-phosphate deacetylase, NagA [82227] (1 protein)

6. Protein N-acetylglucosamine-6-phosphate deacetylase, NagA [82228] (3 species)

7. Species Thermotoga maritima [TaxId:2336] [82229] (1 PDB entry)
   TM0814

8. Domain d1o12b1: 1o12 B:1-43,B:332-364 [80760]
   Other proteins in same PDB: d1o12a2, d1o12b2
   structural genomics
   CASP5
   complexed with fe, mse

Details for d1o12b1

PDB Entry: 1o12, 2.5 Å

PDB Description: crystal structure of n-acetylglucosamine-6-phosphate deacetylase (tm0814) from thermotoga maritima at 2.5 a resolution

PDB Compounds: (B:) N-acetylglucosamine-6-phosphate deacetylase

SCOP Domain Sequences for d1o12b1:

Sequence; same for both SEQRES and ATOM records:

>d1o12b1 b.92.1.5 (B:1-43,B:332-364) N-acetylglucosamine-6-phosphate deacetylase, NagA {Thermotoga maritima [TaxId: 2336]}
mivekvlivdpidgeftgdveieegkivkvekreciprgvlmpXriaegtradlvllded
lnvvmtikegevvfrsr

Timeline for d1o12b1:

• d1o12b1 first appeared in SCOP 1.63
  
• d1o12b1 appears in SCOP 1.73
  
• d1o12b1 appears in SCOPe 2.01
  
• d1o12b1 appears in the current release, SCOPe 2.08