Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (13 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.10: N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain [82261] (1 protein) |
Protein N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain [82262] (2 species) |
Species Thermotoga maritima [TaxId:243274] [82263] (1 PDB entry) TM0814 |
Domain d1o12a2: 1o12 A:44-331 [80759] Other proteins in same PDB: d1o12a1, d1o12b1 |
PDB Entry: 1o12 (more details), 2.5 Å
SCOP Domain Sequences for d1o12a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o12a2 c.1.9.10 (A:44-331) N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain {Thermotoga maritima} gfvdphihgvvgadtmncdfsemeeflysqgvttflattvstslekmkeilrkardyile npstsllgvhlegpyiskekkgahsekhirppserelseidspakmltfapeiesselll rlvkrdivlsaghsiatfeefmkfykegvkrithfpnglkplhhreigitgaglllddvk lelicdgvhlsremvklvykvkkangivlvtdsisaaglkdgtttlgdlvvkvkdgvprl edgtlagstlffsqavknfrkftgcsitelakvssynscvelglddrg
Timeline for d1o12a2: