Lineage for d1o0wa2 (1o0w A:168-236)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946839Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2946840Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2946841Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
    Pfam PF00035
  6. 2946868Protein RNase III, C-terminal domain [54776] (3 species)
  7. 2946894Species Thermotoga maritima [TaxId:2336] [82644] (1 PDB entry)
  8. 2946895Domain d1o0wa2: 1o0w A:168-236 [80752]
    Other proteins in same PDB: d1o0wa1, d1o0wa3, d1o0wb1, d1o0wb3
    CASP5

Details for d1o0wa2

PDB Entry: 1o0w (more details), 2 Å

PDB Description: crystal structure of ribonuclease iii (tm1102) from thermotoga maritima at 2.0 a resolution
PDB Compounds: (A:) Ribonuclease III

SCOPe Domain Sequences for d1o0wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
dyktalqeivqsehkvppeyilvrtekndgdrifvvevrvngktiatgkgrtkkeaekea
ariayekll

SCOPe Domain Coordinates for d1o0wa2:

Click to download the PDB-style file with coordinates for d1o0wa2.
(The format of our PDB-style files is described here.)

Timeline for d1o0wa2: