Lineage for d1o0vb3 (1o0v B:439-546)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221715Species Fc (human) IgE [49121] (3 PDB entries)
  8. 221723Domain d1o0vb3: 1o0v B:439-546 [80750]
    complexed with gol, man, nag, so4; mutant

Details for d1o0vb3

PDB Entry: 1o0v (more details), 2.6 Å

PDB Description: the crystal structure of ige fc reveals an asymmetrically bent conformation

SCOP Domain Sequences for d1o0vb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o0vb3 b.1.1.2 (B:439-546) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgE}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsvnpg

SCOP Domain Coordinates for d1o0vb3:

Click to download the PDB-style file with coordinates for d1o0vb3.
(The format of our PDB-style files is described here.)

Timeline for d1o0vb3: