Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin heavy chain epsilon constant domain 2, CH2-epsilon [88594] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [88595] (2 PDB entries) |
Domain d1o0vb1: 1o0v B:228-330 [80748] Other proteins in same PDB: d1o0va2, d1o0va3, d1o0vb2, d1o0vb3 complexed with gol, so4 |
PDB Entry: 1o0v (more details), 2.6 Å
SCOPe Domain Sequences for d1o0vb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o0vb1 b.1.1.2 (B:228-330) Immunoglobulin heavy chain epsilon constant domain 2, CH2-epsilon {Human (Homo sapiens) [TaxId: 9606]} dftpptvkilqsscdggghfpptiqllclvsgytpgtiqitwledgqvmdvdlstasttq egelastqseltlsqkhwlsdrtytcqvtyqghtfedstkkcad
Timeline for d1o0vb1: