Lineage for d1o0vb1 (1o0v B:228-330)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221715Species Fc (human) IgE [49121] (3 PDB entries)
  8. 221721Domain d1o0vb1: 1o0v B:228-330 [80748]

Details for d1o0vb1

PDB Entry: 1o0v (more details), 2.6 Å

PDB Description: the crystal structure of ige fc reveals an asymmetrically bent conformation

SCOP Domain Sequences for d1o0vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o0vb1 b.1.1.2 (B:228-330) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgE}
dftpptvkilqsscdggghfpptiqllclvsgytpgtiqitwledgqvmdvdlstasttq
egelastqseltlsqkhwlsdrtytcqvtyqghtfedstkkcad

SCOP Domain Coordinates for d1o0vb1:

Click to download the PDB-style file with coordinates for d1o0vb1.
(The format of our PDB-style files is described here.)

Timeline for d1o0vb1: