SCOP 1.73: Domain d1o0va3: 1o0v A:439-545

Lineage for d1o0va3 (1o0v A:439-545)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon [88598] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88599] (3 PDB entries)

8. Domain d1o0va3: 1o0v A:439-545 [80747]
   Other proteins in same PDB: d1o0va1, d1o0va2, d1o0vb1, d1o0vb2

Details for d1o0va3

PDB Entry: 1o0v, 2.6 Å

PDB Description: the crystal structure of ige fc reveals an asymmetrically bent conformation

PDB Compounds: (A:) Immunoglobulin heavy chain epsilon-1

SCOP Domain Sequences for d1o0va3:

Sequence; same for both SEQRES and ATOM records:

>d1o0va3 b.1.1.2 (A:439-545) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens) [TaxId: 9606]}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsvnp

Timeline for d1o0va3:

• d1o0va3 first appeared in SCOP 1.63
  
• d1o0va3 appears in SCOP 1.71
  
• d1o0va3 appears in SCOP 1.75
  
• d1o0va3 appears in the current release, SCOPe 2.08