Lineage for d1o0va3 (1o0v A:439-545)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365012Protein Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon [88598] (1 species)
  7. 365013Species Human (Homo sapiens) [TaxId:9606] [88599] (3 PDB entries)
  8. 365015Domain d1o0va3: 1o0v A:439-545 [80747]
    Other proteins in same PDB: d1o0va1, d1o0va2, d1o0vb1, d1o0vb2

Details for d1o0va3

PDB Entry: 1o0v (more details), 2.6 Å

PDB Description: the crystal structure of ige fc reveals an asymmetrically bent conformation

SCOP Domain Sequences for d1o0va3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o0va3 b.1.1.2 (A:439-545) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens)}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsvnp

SCOP Domain Coordinates for d1o0va3:

Click to download the PDB-style file with coordinates for d1o0va3.
(The format of our PDB-style files is described here.)

Timeline for d1o0va3: