SCOPe 2.06: Domain d1nqia_: 1nqi A:

Lineage for d1nqia_ (1nqi A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein alpha-Lactalbumin [53975] (6 species)
   expressed only in the lactating mammary gland, strongly binds calcium ion

7. Species Mouse (Mus musculus) [TaxId:10090] [69628] (14 PDB entries)

8. Domain d1nqia_: 1nqi A: [80690]
   Other proteins in same PDB: d1nqib_, d1nqid_
   complexed with ca, nag

Details for d1nqia_

PDB Entry: 1nqi, 2 Å

PDB Description: crystal structure of lactose synthase, a 1:1 complex between beta1,4- galactosyltransferase and alpha-lactalbumin in the presence of glcnac

PDB Compounds: (A:) alpha-lactalbumin

SCOPe Domain Sequences for d1nqia_:

Sequence; same for both SEQRES and ATOM records:

>d1nqia_ d.2.1.2 (A:) alpha-Lactalbumin {Mouse (Mus musculus) [TaxId: 10090]}
teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
ekp

Timeline for d1nqia_:

• d1nqia_ first appeared in SCOP 1.63
  
• d1nqia_ appears in SCOPe 2.05
  
• d1nqia_ appears in SCOPe 2.07
  
• d1nqia_ appears in the current release, SCOPe 2.08