Lineage for d1nmub_ (1nmu B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2566728Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2566729Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 2566730Protein Eukaryotic ribosomal protein L30 (L30e) [55317] (2 species)
  7. 2566731Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55318] (4 PDB entries)
    Uniprot P14120
  8. 2566735Domain d1nmub_: 1nmu B: [80666]
    Other proteins in same PDB: d1nmua1, d1nmua2, d1nmuc1, d1nmuc2
    fusion protein with MBP
    complexed with mtt

Details for d1nmub_

PDB Entry: 1nmu (more details), 2.31 Å

PDB Description: mbp-l30
PDB Compounds: (B:) 60s ribosomal protein l30

SCOPe Domain Sequences for d1nmub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmub_ d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
apvksqesinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyyam
lsktkvyyfqggnnelgtavgklfrvgvvsileagdsdilttla

SCOPe Domain Coordinates for d1nmub_:

Click to download the PDB-style file with coordinates for d1nmub_.
(The format of our PDB-style files is described here.)

Timeline for d1nmub_: