SCOPe 2.05: Domain d1nmia_: 1nmi A:

Lineage for d1nmia_ (1nmi A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (6 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (57 PDB entries)
   Uniprot P00044

8. Domain d1nmia_: 1nmi A: [80659]
   complexed with hec, imd

Details for d1nmia_

PDB Entry: 1nmi

PDB Description: solution structure of the imidazole complex of iso-1 cytochrome c

PDB Compounds: (A:) cytochrome c, iso-1

SCOPe Domain Sequences for d1nmia_:

Sequence; same for both SEQRES and ATOM records:

>d1nmia_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate

Timeline for d1nmia_:

• d1nmia_ first appeared in SCOP 1.63
  
• d1nmia_ appears in SCOPe 2.04
  
• d1nmia_ appears in SCOPe 2.06
  
• d1nmia_ appears in the current release, SCOPe 2.08