Lineage for d1nlbl2 (1nlb L:108-214)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365639Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 365760Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)
  8. 365770Domain d1nlbl2: 1nlb L:108-214 [80624]
    Other proteins in same PDB: d1nlbh1, d1nlbh2, d1nlbl1
    part of anti-HCV Fab 19D9D6

Details for d1nlbl2

PDB Entry: 1nlb (more details), 1.6 Å

PDB Description: crystal structure of anti-HCV monoclonal antibody 19D9D6

SCOP Domain Sequences for d1nlbl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nlbl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1nlbl2:

Click to download the PDB-style file with coordinates for d1nlbl2.
(The format of our PDB-style files is described here.)

Timeline for d1nlbl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nlbl1