SCOP 1.67: Domain d1nlbh1: 1nlb H:1-113

Lineage for d1nlbh1 (1nlb H:1-113)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (29 PDB entries)

8. Domain d1nlbh1: 1nlb H:1-113 [80621]
   Other proteins in same PDB: d1nlbh2, d1nlbl1, d1nlbl2
   part of anti-HCV Fab 19D9D6

Details for d1nlbh1

PDB Entry: 1nlb, 1.6 Å

PDB Description: crystal structure of anti-HCV monoclonal antibody 19D9D6

SCOP Domain Sequences for d1nlbh1:

Sequence; same for both SEQRES and ATOM records:

>d1nlbh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4}
qiqlvqsgpelkkpgetvkisckasgytftdfsmhwvnqapgkglnwmgwvntetgepty
addfkgrfafsletsastaylqinslknedtatyfcarfllrqyfdvwgagttvtvss

Timeline for d1nlbh1:

• d1nlbh1 first appeared in SCOP 1.63
  
• d1nlbh1 appears in SCOP 1.65
  
• d1nlbh1 appears in SCOP 1.69
  
• d1nlbh1 appears in the current release, SCOPe 2.08