Lineage for d1nkwr_ (1nkw R:)

  1. Root: SCOPe 2.06
  2. 2268314Class i: Low resolution protein structures [58117] (25 folds)
  3. 2268315Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2268316Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2269333Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 2269468Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 2269469Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)
  8. 2269491Domain d1nkwr_: 1nkw R: [80603]
    CA-atoms only for the ribosomal protein structures

Details for d1nkwr_

PDB Entry: 1nkw (more details), 3.1 Å

PDB Description: Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans
PDB Compounds: (R:) 50S ribosomal protein L23

SCOPe Domain Sequences for d1nkwr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkwr_ i.1.1.2 (R:) Prokaryotic (50S subunit) {Deinococcus radiodurans [TaxId: 1299]}
shydilqapvisekaysamergvysfwvspkatkteikdaiqqafgvrvigistmnvpgk
rkrvgrfigqrndrkkaivrlaegqsiealagq

SCOPe Domain Coordinates for d1nkwr_:

Click to download the PDB-style file with coordinates for d1nkwr_.
(The format of our PDB-style files is described here.)

Timeline for d1nkwr_: