SCOPe 2.02: Domain d1nkwo_: 1nkw O:

Lineage for d1nkwo_ (1nkw O:)

1. Root: SCOPe 2.02

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (1 protein)

6. Protein 50S subunit [58125] (6 species)

7. Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)

8. Domain d1nkwo_: 1nkw O: [80600]
   CA-atoms only for the ribosomal protein structures

Details for d1nkwo_

PDB Entry: 1nkw, 3.1 Å

PDB Description: Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans

PDB Compounds: (O:) 50S ribosomal protein L20

SCOPe Domain Sequences for d1nkwo_:

Sequence; same for both SEQRES and ATOM records:

>d1nkwo_ i.1.1.2 (O:) 50S subunit {Deinococcus radiodurans [TaxId: 1299]}
praktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrlw
iqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrnarq

Timeline for d1nkwo_:

• d1nkwo_ first appeared in SCOP 1.63
  
• d1nkwo_ appears in SCOPe 2.01
  
• d1nkwo_ appears in SCOPe 2.03
  
• d1nkwo_ appears in the current release, SCOPe 2.08