Lineage for d1nkwh_ (1nkw H:)

  1. Root: SCOPe 2.03
  2. 1467789Class i: Low resolution protein structures [58117] (25 folds)
  3. 1467790Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1467791Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1468643Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1468644Protein 50S subunit [58125] (6 species)
  7. 1468645Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)
  8. 1468657Domain d1nkwh_: 1nkw H: [80593]
    CA-atoms only for the ribosomal protein structures

Details for d1nkwh_

PDB Entry: 1nkw (more details), 3.1 Å

PDB Description: Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans
PDB Compounds: (H:) 50S ribosomal protein L13

SCOPe Domain Sequences for d1nkwh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkwh_ i.1.1.2 (H:) 50S subunit {Deinococcus radiodurans [TaxId: 1299]}
vktyipkndeqnwvvvdasgvplgrlatliasrirgkhrpdftpnmiqgdfvvvinaaqv
altgkklddkvytrytgyqgglktetarealskhperviehavfgmlpkgrqgramhtrl
kvyagethphsaqkpqvlktqpl

SCOPe Domain Coordinates for d1nkwh_:

Click to download the PDB-style file with coordinates for d1nkwh_.
(The format of our PDB-style files is described here.)

Timeline for d1nkwh_: