SCOP 1.75: Domain d1njmk_: 1njm K:

Lineage for d1njmk_ (1njm K:)

1. Root: SCOP 1.75

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (1 protein)

6. Protein 50S subunit [58125] (6 species)

7. Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)

8. Domain d1njmk_: 1njm K: [80548]
   complexed with a tRNA acceptor stem mimic (asm) and the antibiotic sparsomycin

Details for d1njmk_

PDB Entry: 1njm, 3.6 Å

PDB Description: The crystal structure of the 50S Large ribosomal subunit from Deinococcus radiodurans complexed with a tRNA acceptor stem mimic (ASM) and the antibiotic sparsomycin

PDB Compounds: (K:) 50S ribosomal protein L16

SCOP Domain Sequences for d1njmk_:

Sequence; same for both SEQRES and ATOM records:

>d1njmk_ i.1.1.2 (K:) 50S subunit {Deinococcus radiodurans [TaxId: 1299]}
tkfrkqfrgrmtgdakggdyvafgdygliamepawiksnqieacrivmsrhfrrggkiyi
rifpdkpvtkkpaetrmgkgkgaveywvsvvkpgrvmfevagvteeqakeafrlaghklp
iqtk

Timeline for d1njmk_:

• d1njmk_ first appeared in SCOP 1.63
  
• d1njmk_ appears in SCOP 1.73
  
• d1njmk_ appears in SCOPe 2.01
  
• d1njmk_ appears in the current release, SCOPe 2.08