Lineage for d1ni2b3 (1ni2 B:2-87)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717081Superfamily d.15.1: Ubiquitin-like [54236] (7 families) (S)
  5. 717395Family d.15.1.4: First domain of FERM [54256] (6 proteins)
  6. 717401Protein Ezrin [82581] (1 species)
  7. 717402Species Human (Homo sapiens) [TaxId:9606] [82582] (1 PDB entry)
  8. 717404Domain d1ni2b3: 1ni2 B:2-87 [80530]
    Other proteins in same PDB: d1ni2a1, d1ni2a2, d1ni2b1, d1ni2b2

Details for d1ni2b3

PDB Entry: 1ni2 (more details), 2.3 Å

PDB Description: structure of the active ferm domain of ezrin
PDB Compounds: (B:) Ezrin

SCOP Domain Sequences for d1ni2b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ni2b3 d.15.1.4 (B:2-87) Ezrin {Human (Homo sapiens) [TaxId: 9606]}
pkpinvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwyfglhyvdnkgfptwlkl
dkkvsaqevrkenplqfkfrakfype

SCOP Domain Coordinates for d1ni2b3:

Click to download the PDB-style file with coordinates for d1ni2b3.
(The format of our PDB-style files is described here.)

Timeline for d1ni2b3: