Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (7 families) |
Family d.15.1.4: First domain of FERM [54256] (6 proteins) |
Protein Ezrin [82581] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82582] (1 PDB entry) |
Domain d1ni2b3: 1ni2 B:2-87 [80530] Other proteins in same PDB: d1ni2a1, d1ni2a2, d1ni2b1, d1ni2b2 |
PDB Entry: 1ni2 (more details), 2.3 Å
SCOP Domain Sequences for d1ni2b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ni2b3 d.15.1.4 (B:2-87) Ezrin {Human (Homo sapiens) [TaxId: 9606]} pkpinvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwyfglhyvdnkgfptwlkl dkkvsaqevrkenplqfkfrakfype
Timeline for d1ni2b3: