SCOPe 2.05: Domain d1nhya1: 1nhy A:76-219

Lineage for d1nhya1 (1nhy A:76-219)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein GST-like domain of elongation factor 1-gamma [81772] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81773] (1 PDB entry)

8. Domain d1nhya1: 1nhy A:76-219 [80520]
   Other proteins in same PDB: d1nhya2
   complexed with so4

Details for d1nhya1

PDB Entry: 1nhy, 3 Å

PDB Description: crystal structure of the gst-like domain of elongation factor 1-gamma from saccharomyces cerevisiae.

PDB Compounds: (A:) Elongation factor 1-gamma 1

SCOPe Domain Sequences for d1nhya1:

Sequence; same for both SEQRES and ATOM records:

>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ddkmktqllgadddlnaqaqiirwqslansdlciqiantivplkggapynkksvdsamda
vdkivdifenrlknytylatenisladlvaasiftryfeslfgtewraqhpaivrwfntv
raspflkdeykdfkfadkplsppq

Timeline for d1nhya1:

• d1nhya1 first appeared in SCOP 1.63
  
• d1nhya1 appears in SCOPe 2.04
  
• d1nhya1 appears in SCOPe 2.06
  
• d1nhya1 appears in the current release, SCOPe 2.08