Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (7 families) |
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) |
Protein alpha-Lactalbumin [53975] (6 species) expressed only in the lactating mammary gland, strongly binds calcium ion |
Species Mouse (Mus musculus) [TaxId:10090] [69628] (9 PDB entries) |
Domain d1nhec_: 1nhe C: [80514] Other proteins in same PDB: d1nheb_, d1nhed_ complexed with ca, mse, pg4, udp |
PDB Entry: 1nhe (more details), 2.5 Å
SCOP Domain Sequences for d1nhec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nhec_ d.2.1.2 (C:) alpha-Lactalbumin {Mouse (Mus musculus)} teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc ekp
Timeline for d1nhec_: