SCOP 1.71: Domain d1nhec_: 1nhe C:

Lineage for d1nhec_ (1nhe C:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein alpha-Lactalbumin [53975] (6 species)
   expressed only in the lactating mammary gland, strongly binds calcium ion

7. Species Mouse (Mus musculus) [TaxId:10090] [69628] (9 PDB entries)

8. Domain d1nhec_: 1nhe C: [80514]
   Other proteins in same PDB: d1nheb_, d1nhed_
   complexed with ca, mse, pg4, udp

Details for d1nhec_

PDB Entry: 1nhe, 2.5 Å

PDB Description: Crystal structure of Lactose synthase complex with UDP

SCOP Domain Sequences for d1nhec_:

Sequence; same for both SEQRES and ATOM records:

>d1nhec_ d.2.1.2 (C:) alpha-Lactalbumin {Mouse (Mus musculus)}
teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
ekp

Timeline for d1nhec_:

• d1nhec_ first appeared in SCOP 1.63
  
• d1nhec_ appears in SCOP 1.69
  
• d1nhec_ appears in SCOP 1.73
  
• d1nhec_ appears in the current release, SCOPe 2.08