SCOP 1.73: Domain d1nhaa_: 1nha A:

Lineage for d1nhaa_ (1nha A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.30: C-terminal domain of the rap74 subunit of TFIIF [63480] (1 protein)

6. Protein C-terminal domain of the rap74 subunit of TFIIF [63481] (1 species)
   peptide-recognition motif

7. Species Human (Homo sapiens) [TaxId:9606] [63482] (4 PDB entries)

8. Domain d1nhaa_: 1nha A: [80509]

Details for d1nhaa_

PDB Entry: 1nha

PDB Description: solution structure of the carboxyl-terminal domain of rap74 and nmr characterization of the fcp-binding sites of rap74 and ctd of rap74, the subunit of human tfiif

PDB Compounds: (A:) transcription initiation factor iif, alpha subunit

SCOP Domain Sequences for d1nhaa_:

Sequence; same for both SEQRES and ATOM records:

>d1nhaa_ a.4.5.30 (A:) C-terminal domain of the rap74 subunit of TFIIF {Human (Homo sapiens) [TaxId: 9606]}
dvqvtedavrryltrkpmttkdllkkfqtkktglsseqtvnvlaqilkrlnperkmindk
mhfslke

Timeline for d1nhaa_:

• d1nhaa_ first appeared in SCOP 1.63
  
• d1nhaa_ appears in SCOP 1.71
  
• d1nhaa_ appears in SCOP 1.75
  
• d1nhaa_ appears in the current release, SCOPe 2.08