Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (178 PDB entries) Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor |
Domain d1ngzb1: 1ngz B:1-114 [80502] Other proteins in same PDB: d1ngza1, d1ngza2, d1ngzb2 part of metal chelatase catalytic Fab 7G12; chimeric germline antibody |
PDB Entry: 1ngz (more details), 1.6 Å
SCOPe Domain Sequences for d1ngzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ngzb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} qvqllesgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky nekfkskatltvdkpsstaymqlssltsedsavyyctrrdsdywgagttvtvss
Timeline for d1ngzb1: