Lineage for d1ngza2 (1ngz A:108-213)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1761687Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1761688Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 1761909Domain d1ngza2: 1ngz A:108-213 [80501]
    Other proteins in same PDB: d1ngza1, d1ngzb1, d1ngzb2
    part of metal chelatase catalytic Fab 7G12; chimeric germline antibody

Details for d1ngza2

PDB Entry: 1ngz (more details), 1.6 Å

PDB Description: Chimeric Germline Fab 7g12-apo
PDB Compounds: (A:) Germline Metal Chelatase Catalytic Antibody, Light chain

SCOPe Domain Sequences for d1ngza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngza2 b.1.1.2 (A:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d1ngza2:

Click to download the PDB-style file with coordinates for d1ngza2.
(The format of our PDB-style files is described here.)

Timeline for d1ngza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ngza1