Lineage for d1ngza1 (1ngz A:1-107)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 220140Species Metal chelatase catalytic Fab 7G12, (human), kappa L chain [48879] (5 PDB entries)
  8. 220147Domain d1ngza1: 1ngz A:1-107 [80500]
    Other proteins in same PDB: d1ngza2, d1ngzb2

Details for d1ngza1

PDB Entry: 1ngz (more details), 1.6 Å

PDB Description: Chimeric Germline Fab 7g12-apo

SCOP Domain Sequences for d1ngza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngza1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Metal chelatase catalytic Fab 7G12, (human), kappa L chain}
elvmtqtpkfmstsvgdrvsitckasqnvgtavawyqqkpgqspklliysasnrytgvpd
rftgsgsgtdftltisnmqsedladyfcqqyssypltfgggtkveik

SCOP Domain Coordinates for d1ngza1:

Click to download the PDB-style file with coordinates for d1ngza1.
(The format of our PDB-style files is described here.)

Timeline for d1ngza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ngza2